Earnest Research is a VC-backed data innovation startup driven to change the way professionals understand consumer and business behavior. Working with world-class data partners, we transform raw data into a source for business and investment professionals to ask better questions so they can make better decisions. We believe, in the right hands, data has the power to change the way we work.

scalahaskellpythonjavascriptremote workinghealth insurancepaid sick dayspension contributions401kunlimited vacationpaid leaveproduct impactseries bfinance

Precision Development (PxD) is a global non-profit organization that harnesses technology, data science, and research to empower people living in poverty and improve their lives. By providing actionable information to the right people, in the right way and at the right time, we empower poor people living in developing countries to improve their livelihoods, mitigate risks, and advance environmental sustainability. We provide customized and timely information to users via their mobile devices. We work with partners to build, scale and improve mobile phone-based agricultural extension and other digital development initiatives to increase the productivity and income of extremely poor and vulnerable families around the world. PxD currently works in ten countries in Africa, Asia, and Latin America, and is rapidly expanding as governments and organizations look for innovative ways to utilize new technologies to deliver actionable information to people who need it. As of the end of the second quarter of 2021, PxD was serving 4.4 million farmers through a range of initiatives providing tailored information on crop optimization, pest management, input utilization, and environmental stewardship. PxD also leverages mobile technology to deliver information in sectors beyond agriculture, including a two-way SMS service to facilitate math education in Kenya.

erlangpythonansiblepostgresqldocker swarmr shinyremote workingparental leavelearning & development publictechnology

47 Degrees is a global consulting firm specializing in functional programming. Our team is comprised of a unique set of individuals, specializing in their own respective fields of development. Since 2010, we have used our expertise to build, deploy, and innovate applications for our clients and internal projects. We’re active community members whether we’re organizing or sponsoring events, speaking at conferences, or creating open source projects for the benefit of the ecosystem. Our team is spread across two continents but unified by a single desire to create amazing experiences for our clients. You can learn more about our work on our website: https://www.47deg.com/services/our-work/

scalaakkafunctional programmingkafkakotlinmicroservicessparkhaskell + scala developmentfunctional scalaremote workingflexible workingpaid time offstrong bonus incentivesprivate

Consolidate digital marketplaces faster When it comes to scaling and aggregating sellers on digital marketplaces what matters most is speed. With Xapix you automate the integration and governance processes and significantly speed up your deal execution. We’re pioneers in the fast-growing eCommerce aggregation space, where a wealth of data is trapped behind APIs across multiple marketplaces such as Amazon and Shopify. Our job is to help eCommerce aggregators make fast and accurate business decisions, by providing automated seller reporting, data visualization, and unique insights.

rubydockerawsazurekuberneteskafkarailsruby on railsvue.jsflinkflexible workingbookspaid sick daysdaily stand up

At ITV, we’re passionate about the same things you are: typed functional programming in Scala using the Typelevel stack. We have a continuous development mindset, always looking to grow the capabilities of our engineering teams, giving them the autonomy and power to steer the technical direction and operate a build it, run it style of working practice. We contribute to the wider Engineering community as part of our day-to-day work via conferences and open source contributions and we have fun on the way to meeting our strategic goals. We're early adopters who prefer to move fast, experiment and break things. Our teams are supportive, collaborative and open-minded; and always on the lookout for new and better ways of doing things. Across the business, ITV has placed technology at the heart of its ambitious new strategy, adapting to changing consumer behaviour around how they'd like their content delivered. Once upon a time, we scheduled our lives around our favourite show, now the shows work around us and we at ITV are consistently looking for ways to help shape that. Technology increasingly drives everything we do, we have teams in On Demand, Content Technology, Core Ad Tech and Behavioural Data that consistently strive to use modern engineering methods and tech to deliver best-in-class service to our consumers. Media and Entertainment is a forever advancing and fast-paced industry, consumer behaviours are changing all the time and we are looking for talented engineers to help us scale and innovate whilst maintaining the high quality of products and services we create. ITV On Demand is home to the platform that powers the ITV Hub and BritBox UK. Last year the Hub served over 1.8 billion videos to over 30 million users across 29 platforms including Amazon Fire, Xbox, Android and iOS devices to name but a few. We’re constantly expanding with year-on-year video delivery increasing by 23%. BritBox is ITV’s joint venture with the BBC and other content partners, that aims to deliver a best-in-class subscription video service for great British content - all powered by technology battle-tested on the Hub.

scalaelmpythonjavaawsci/cdcatsgithubhttp4snosqlrestscalazslackterraform

We're building a better financial world. Over the past ten years, we have built a machine learning and technology platform that is revolutionising how small businesses access finance. Business owners can complete a loan application and receive a decision in a matter of minutes, enabling them to get funding quickly at an affordable rate. Today, as the leading global provider for small business loans we have helped more than 100,000 small businesses access more than £11.5 billion in finance. Funding Circle is the largest online small business loans provider and one of the best-capitalised lending platforms in the world. The business is listed on the London Stock Exchange (Ticker: FCH). Our backers collectively manage over $5 trillion and are the leading firms behind Facebook, Twitter, Skype and Betfair. Build the incredible, with us!!

clojurejavarubyjavascriptreacthtmlcsslinuxdockerawsci/cdcode qualitycode reviewsfunctional programming

Gemini Trust Company, LLC (Gemini) is a licensed digital asset exchange and custodian. We built the Gemini platform so customers can buy, sell, and store digital assets (e.g., Bitcoin, Ethereum, and Zcash) in a regulated, secure, and compliant manner. Digital assets and blockchain technology have the power to transform the world for good. This truth, along with our core values, form the bedrock of our company and culture. At Gemini, no job is too small and no project too big as we endeavor to build the future of money. We are a mission-driven, team-based, inclusive, and determined community of thought leaders who invest in each other and the long game. Come join the Gemini team and help us build the future of money. We believe in the transformational power of digital assets, and want to work with people who have passion, integrity, and perseverance. We’re committed to excellence and building a truly galaxy-changing team. If this sounds like you, apply for a seat on the Gemini Spaceship today! 🚀

scalapythonjavac++javascriptlinuxansibleci/cdcode reviewscompliancephysical data centrebare metal environmentmonitoringon call

Open Editions is an initiative to publish richly-annotated, open-source, and machine-readable public domain literary texts. We use Haskell to transform texts encoded in TEI XML, and Python to analyze these texts. We seek volunteers and pull requests from the public.

haskellpythonxmlnatural language processingpython pandasremote workingprivateeducation

Our mission is to reduce the death rate of small businesses We are a financial tech company that aligns qualifications, predicts needs, and facilitates transactions between data providers, lenders, partners, and small businesses. Nav is democratizing small business financing. In other words, we give small business owners access and control. Yes, this challenges the norm, but it means working with curious, purpose driven, dedicated, and inquisitively smart people who push themselves, our company and the community to the next level (and every level after that). We are the people behind the tech. And when it’s good, we look for better. We don’t over think the value we bring nor spend time trying to revamp mantras. We also do not come up with some crafty way to tell you who we are and what we offer. We are Nav! Here, you’ll gain a wealth of experience, learn the tricks of the trade, and work with winners. All companies say people are connected to their mission but in our case our mission and our people are one – it is a way of being not just a cause you are committed to. And since 2013, Nav has holistically and organically developed its own ideology because Nav can only be Nav.

elixirpythonrubynode.jsreactdockerawsgolanggraphqlkubernetesmicroservice, golangreduxsalesforceagile methodology

H-E-B Digital is a little different than the average tech company. Like most corporate success stories, ours has a humble beginning, but it doesn’t start in a garage or with an algorithm. Instead, the H-E-B story starts with an ill husband, a determined wife, and three children to feed. Armed with just $60 and her wits, in 1905 our founder, Mrs. Florence Butt, opened a grocery store in her home and set in motion a generation-spanning commitment to feed not just her own children, but everyone in her state. 100+ years, 400+ stores, 5 different brands, one international expansion, and a few billion dollars in charitable contributions later, we’re getting closer to meeting that goal, but there’s still so much work to do. That’s where you come in. The digital arm of a brick and mortar institution, H-E-B Digital is tasked with providing solutions at scale for every part of the business. We create digital products for the millions of households that shop at H-E-B, but also for the 120,000+ employees who serve those households alongside us, from the teenager working their first job to the classically trained chef. But we don’t stop at the store: Our support spans from the farmers that grow our food to the drivers and warehouse workers that bring that food to the stores to the business functions that develop, source, package and sell that food, to the teams that give back to the community with the profits that food brings in. Our teams of engineers and analysts, designers and researchers, eCommerce experts and managers of all stripes are assembled and ready to tackle the hardest tech and digital problems. All we’re missing is you.

scalaclojurehaskellhealth insurancegenerous ptoflexible spending account401kprivateretail

Furnish.app is your furniture personal shopper, delivering you recommendations to your taste and budget in minutes – all online and completely free.

f#reactherokupostgresqlslacktypescriptgoogle anlayticsaws elastic beanstalkamazon s3g-suiteconfluenceremote workingprivateretail

Select Star is an intelligent data discovery platform that automatically analyzes & documents your data. Many data scientists and business analysts spend too much time looking for the right data, often having to ask other people to find it. Select Star is uniquely good at helping you understand your data - what data you have, where it lives, how it's structured, and how it's being used. ⭐

reactdockerawsd3.jsdjangokafkasparktypescriptairflowremote workingfemale foundersequityremote workingearly stage

scalahaskellelixirpythonjavascriptreactreact nativetddtypescripttype-safe

We believe that making the best possible use of the web is the way to turn useful data into valuable insights 🚀. Swirrl's PublishMyData software platform helps government organisations to make their data more accessible and re-usable, enabling better informed decisions. 🔎 Transforming how government finds data PublishMyData wraps your data in world-class search, browse and discovery technology. Users can explore by topic, map and natural language search. Specialists can also use details of vocabularies and classification schemes to filter data or use the full featured query language for the most precise or complex search requirements. 🧠 Transforming how government understands data PublishMyData helps you annotate, cross-reference and document your data, making it self-describing. All your users can rely on common clear, precise and consistent definitions of every term in your domain, allowing them to apply data with confidence. Datasets can be illuminated and enriched with explanatory notes and details of methodology. 🔌 Transforming how government connects data PublishMyData weaves your data into a graph, breaking it out of silos and joining it to other data from inside and outside your organisation to enable new connections and new comparisons. 📈 Transforming how government uses data PublishMyData makes your data ready to use anywhere: combine data sources to create custom spreadsheets on the desktop; syndicate the data into offline systems; power online apps and visualisations. 🎛 Transforming how government manages data PublishMyData puts you in control of your data. Edit, transform, load, validate and publish your data in teams, or automate and integrate the process into code workflows. Be confident that your publishing is timely, trustworthy and reliable.

clojureclojurescriptjavascriptreactawsgcpgraphqlremote workingflexible workinglaptop30 days annual leave + bank holidaysequipment budgetprivatetechnology

ChainSafe Systems is a blockchain R&D firm on a mission to realize the potential of Web3 infrastructure through sustainable, open-source development. Our vision is to create a world with organizations that empower people to build and innovate through blockchain agnostic tools and other distributed technologies. We are global leaders in the industry, unique in our work across multiple blockchain ecosystems, and currently are pioneering technology and infrastructure related to Ethereum, Cosmos, Polkadot and Filecoin. We are actively pursuing the development of our own product suite, having recently released Files, which allows users to upload and store files on IPFS and Filecoin with the goal of furthering development to provide a decentralized alternative to cloud storage. ChainSafe is a unique company in a unique space, growing quickly and building a global reputation in this nascent space. Beyond offering experience across every major blockchain space to our team, we provide an open, inclusive, and supportive environment where we help folks reach their full potential as a human and as a professional. Here’s what you might want to know before reading on: Our stack is progressive and open-source and includes Go, Rust, and TypeScript. We spearhead ecosystem projects like Lodestar, Web3.js, Forest, and Gossamer. We are global, remote-friendly, and open to contractors (who can commit to a minimum of 35 hours a week). For those local to Toronto, our casual, open-concept office in Chinatown has meeting rooms, lounge areas, and space to pull up a chair. Culture fit and alignment to our core values are extremely important to us. We are fueled by an immense intellectual curiosity of what technology can do and the impact it can have. You will thrive here if you are intensely driven by tackling technical challenges that no one else has solved yet and are inspired by the possibility of building the next generation of web infrastructure and decentralized systems.

rustgolangmicroservice, golangjavascript / typescriptremote workingflexible workingunlimited vacation policyflexible workingremote workingprivatetechnology

SundaeSwap is developing the first DEX on the Cardano Blockchain.

haskellrustreactcardanonextjsjavascript / typescriptremote workingflexible workingpaid sick daystoken equitycommitted to a diverse team publicblockchain

Haystack builds delivery analytics for engineering teams. We help teams measure, improve, and establish best practices using our suite of analytics & alerts. We are backed by Y Combinator and the same people who have built Doordash, Airbnb, and Optimizely. We work with world class engineering leaders at companies like Microsoft, Robinhood, and The Economist.

node.jsreactgitgithubgoogle cloudpostgresqlreact hookstypescriptpostgressdigital oceangoogle cloudgithub actionsreact jsdigitalocean

CAIS is the first truly open marketplace for alternative investments, where financial advisors and asset managers can engage and transact directly on a massive scale.

elixirelmjavaremote workinghealth insurance401kperformance-based bonuspaid lunchseries afinance

Talenthouse connects brands and agencies with the largest on-demand creative community in the world. One that consists of creators with a completely unique, diverse and authentic voice Our technology and experienced team enables brands to produce original ideas, concepts, and high quality branded content – quickly, cost-effectively and at scale Planning and management of multi-layered marketing and influencer campaigns driving reach and engagement with core audiences Create high volumes of diverse on-brand work (Creative Brief) or select a more targeted approach via direct creative commissions (Private Brief) Drive brand ROI and conversions/promotions/offers through editorial media packages to our creative community and our Influencer Attribution Tool

scalaremote workingflexible workinggenerous ptoseries cadvertising